PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna02643.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 654aa    MW: 72445.9 Da    PI: 8.5619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna02643.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.8e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             rg+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  mrna02643.1-v1.0-hybrid 14 RGPWSPEEDSKLKSYIELHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                             89*********************************************97 PP

2Myb_DNA-binding36.88.8e-1269111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eEd l+  +    G++ W+ Ia+ ++ gRt++++k++w++
  mrna02643.1-v1.0-hybrid  69 GGFSEEEDNLICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.885962IPR017930Myb domain
SuperFamilySSF466891.09E-2511109IPR009057Homeodomain-like
SMARTSM007171.4E-121364IPR001005SANT/Myb domain
PfamPF002492.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-241569IPR009057Homeodomain-like
CDDcd001672.69E-91662No hitNo description
PROSITE profilePS5129421.76863117IPR017930Myb domain
SMARTSM007173.3E-1167115IPR001005SANT/Myb domain
PfamPF002491.5E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2370117IPR009057Homeodomain-like
CDDcd001675.45E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MGRAPCCDKA NVKRGPWSPE EDSKLKSYIE LHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNLIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
HRKEHQAAAR RSAAGLKQQE LIKRGLIISN GNNNSMVNVN PLGADSQNPY WPELPVIQGP  180
SIPNYSSPNQ EVAVPSFNDH ASIRKLLIKL GGRFHSDHQD NVVQPKIQDV YSLNVNIQLP  240
VDDQFPSSTQ QIYHEESAAN MHSSASPIAT VASNNISSPG QFAQMSDYNN HTGNAGDGDA  300
MNMFQGGQSS HYLLSNELKD MVYNIDREKL DGLEFLYSDD IMIMMNDRPI SSTTSTNTSY  360
GTDQSTMGWS GPEQMQLVYP PPPLAASGSD YHEGMQRLIM PQEQCANFCG LRENAGDKGR  420
QNQTATMAFP ASLSSPSSST PKFPLNLSKP KTSQPQKCLI LRLPHKPFQT SCAKVVSMSQ  480
FGEPNKGHNQ ALEIKVVKEK LLEAIPVTVK ELPWKRAADI ALKQMLCLGE KALKWCLVAF  540
FVLSFFSDVI FSISRNRELV IPFGLFVGCF VTEILKEALQ LVLPVSEEKG FEKHLIGIGC  600
LFAAVKFISY GLPIQAQVIV LNVANGGFLQ VLWLWRGLFN RSDVGNSAMD VTM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-24141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004292782.10.0PREDICTED: transcription factor RAX3-like
TrEMBLM5XI081e-129M5XI08_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0002s11440.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-76myb domain protein 84